El receptor cannabinoide CB1 pertenece a la familia de los receptores de siete hélices transmembrana asociados a proteínas G, tipo rodopsina. Consta de 472 residuos. A este receptor se une la anandamida ‘N-araquidoniletanolamida’, el THC principal componente activo de la marihuana y otros agonistas. La estructura atómica del receptor proviene de aproximaciones matemáticas.

La anandamida interacciona con la Hélice transmembrana 6, desplaza la hélice a un lado, cambiando la conformación de la proteína. Ver video animación 3d simulada de la señalización neuronal retrograda mediada por el receptor cannabinode.

Receptor cannabinoide CB1

Modelo del Receptor cannabinoide CB1 calculado unido a anandamida.

Modelo del receptor cannabinode humano CB1. Partiendo de la base de la estructura delrodopsina 2z73a y calculando comparativamente con la secuencia de aminoácidos de ambos, se llega a una estructura tridimensional. El 3D lo podemos encontrar en modBase que es una base de datos de modelos de proteínas calculados por modelado compartivo.

Simulaciones por ordenador llevadas a cabo en el Pittsburgh Supercomputing Center apuntan que la anandamida puede unirse al receptor CB1 como de forma parecida a como se muestra en la figura. Parece ser que la anandamida se encuentra fundamentalmente en su forma extendida dentro del receptor. Interaccionando en su parte más baja con una valina V3.43 y una isoleucina I6.46 de la hélice transmembrana 6 TM6. K3.28

Secuencia de la proteína completa con los aminoácidos del modelo calculado en verde.

KSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEK
MTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV
LSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFH
RKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMW
TIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKA
HSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLA
IMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQP
LDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Patricia H. Reggio, Computational Methods in Drug Design: Modeling G Protein-Coupled Receptor Monomers, Dimers, and Oligomers. AAPS Journal. 2006; 8(2): E322-E336.

Anuncios

Responder

Introduce tus datos o haz clic en un icono para iniciar sesión:

Logo de WordPress.com

Estás comentando usando tu cuenta de WordPress.com. Cerrar sesión / Cambiar )

Imagen de Twitter

Estás comentando usando tu cuenta de Twitter. Cerrar sesión / Cambiar )

Foto de Facebook

Estás comentando usando tu cuenta de Facebook. Cerrar sesión / Cambiar )

Google+ photo

Estás comentando usando tu cuenta de Google+. Cerrar sesión / Cambiar )

Conectando a %s