Llegada Inesperada!

Ayer a media tarde, recibi la gratificante visita de un amigo tan bueno que me trajo una sorpresa inesperada, ¡¡¡¡¡¡4 esquejes de Lavender Soma!!!!!!!!. no puedo decir que sea mi variedad favorita, aun no e dado con ella, asi que sigo buscando y probando. son de dudosa procedencia pero las caracteristicas tecnicas son estas:

    Lavender Soma #10
BANCO Soma Seeds
DESCRIPCIÓN Lavender Soma #10 reconcilia el mundo de la hierbaCogollos con historias que atraviesan Afghanista, Hawaii, Korea, U.S, y Europa , estan juntados en este triple cruce. Una variedad de mirada exótica, Soma 10 desarrolla la coloración púrpura mas oscura que te puedes imaginar. El color es intenso, con las hojas que se vuelven casi negras cuando acaba, profundamente saturadas de color. Los cogollos extra densos emiten un olor sensualmente picante, semejante al hachís Afgano. El calyx es grande en proporción a la hoja y la poca hoja de esta planta hace que su manicurado sea simple. Mientras no es tan alta como la variedad Haze, Soma 10 puede pegar un tirón de altura cuando se le permite un periodo de vegetación mas amplio antes de que llegue a la floración. De ser cultivada en S.O.G. Soma recomienda mantener controlado el ciclo vegetativo para controlar la altura. Esta variedad tambien es buena como planta ramificada. Al aire libre esta variedad prospera mucho en zonas mas templadas, aunque los climas aridos conocidos por su rica agricultura son tambien óptimos. Soma 10 tiene un sabor similar al hachís Afgano, produciendo un colocón encantador que circula por todos los chakras. Un numo para dias fabulosos, o tardes lluviosas, Soma 10 te dejará sentirte relajado y suave, posiblemente a punto de dormirte.
MODALIDAD DE CULTIVO No Esp.
SEXO Indeterminado/Feminizada
TIPO Híbrido con predominancia Índica
ORIGEN No Especificado
CRUCE Super skunkxBig Skunk KoreanxAfghani-Hawaiian
ALTURA No Especificado
ANCHURA Ramificada
TIEMPO DE VEGETATIVO No Especificado
FLORACIÓN INTERIOR 61/65 días

Cannabinoides y Sistema Endocannabinoide

Soy una gran aficionada a la lectura por lo que me suele gustar mis dos aficiones (leer y fumar)  y aprender sobre el funcionamiento del cannabis en el cuerpo. ¿porque me gusta tanto?, ¿a que se debe ese efecto tan intenso?… asi, leyendo aqui y allí e dado con este articulo que me ha parecido interesante. explica claramente el funcionamiento de los agentes activos presentes en la marihuana, asi como la forma  de asimilación del cuerpo de los mismos. Este es el articulo.

Sistema Receptor Cannabinoide: unión de la Anandamida al CBD 1 en 3D

El receptor cannabinoide CB1 pertenece a la familia de los receptores de siete hélices transmembrana asociados a proteínas G, tipo rodopsina. Consta de 472 residuos. A este receptor se une la anandamida ‘N-araquidoniletanolamida’, el THC principal componente activo de la marihuana y otros agonistas. La estructura atómica del receptor proviene de aproximaciones matemáticas.

La anandamida interacciona con la Hélice transmembrana 6, desplaza la hélice a un lado, cambiando la conformación de la proteína. Ver video animación 3d simulada de la señalización neuronal retrograda mediada por el receptor cannabinode.

Receptor cannabinoide CB1

Modelo del Receptor cannabinoide CB1 calculado unido a anandamida.

Modelo del receptor cannabinode humano CB1. Partiendo de la base de la estructura delrodopsina 2z73a y calculando comparativamente con la secuencia de aminoácidos de ambos, se llega a una estructura tridimensional. El 3D lo podemos encontrar en modBase que es una base de datos de modelos de proteínas calculados por modelado compartivo.

Simulaciones por ordenador llevadas a cabo en el Pittsburgh Supercomputing Center apuntan que la anandamida puede unirse al receptor CB1 como de forma parecida a como se muestra en la figura. Parece ser que la anandamida se encuentra fundamentalmente en su forma extendida dentro del receptor. Interaccionando en su parte más baja con una valina V3.43 y una isoleucina I6.46 de la hélice transmembrana 6 TM6. K3.28

Secuencia de la proteína completa con los aminoácidos del modelo calculado en verde.

KSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEK
MTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV
LSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFH
RKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMW
TIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKA
HSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLA
IMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQP
LDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Patricia H. Reggio, Computational Methods in Drug Design: Modeling G Protein-Coupled Receptor Monomers, Dimers, and Oligomers. AAPS Journal. 2006; 8(2): E322-E336.

Composición, agentes activos. Canabinoides y sistema receptor endocannabico

Los efectos medicinales y psicoactivos de la marihuana se deben a una familia de compuestos químicos, denominados cannabinoides, que se encuentran solamente en la planta de la marihuana.

Por lo menos 61 cannabinoides han sido identificados en la naturaleza. Otros han sido sintetizados químicamente.

El principal ingrediente psicoactivo de la marihuana es el delta-9- tetrahidrocannabinol, o THC, a veces confusamente llamado delta-1-THC bajo un sistema de denominación distinto.

De cualquier modo, otros cannabinoides presentes en el cannabis también tienen propiedades medicinales y/o psicoactivas.

El Cannabigerol (CBG), cannabicromeno (CBC), cannabidiol (CDB), delta-8-THC, cannabiciclol (CBL), cannabinol (CBN), cannabitriol (CBT), cannabavarina (THCU) y otros cannabinoides forman parte de esta familia de compuestos.

Todos ellos son conocidos por su psicoactividad o efectos farmacológicos. Dado que el delta-9-THC es el principal ingrediente activo de la marihuana, se suele usar este para medir el potencial de acción de la hierba. Las concentraciones típicas de THC son de menos del 0,5% para un cáñamo inactivo, del 2 al 3% para la hoja de marihuana, y del 4 al 8% para los cogollos más potentes de la sinsemilla. Se pueden encontrar concentraciones más elevadas con extractos, tónicos y hachís (resma concentrada de cannabis).

Las dosis terapéuticas por vía oral comprenden desde 2,5 a 20 miligramos de THC. Un porro mediano (un gramo de hoja con un 2,5% de THC. o medio gramo de cogollo de un 5% de concentración), contiene 25 miligramos de THC.

En todo caso, más de la mitad se pierde normalmente con el humo, reduciendo la dosis inhalada a unos 10 miligramos.

Consumidores experimentados han informado sobre el hecho de que diferentes tipos de marihuana producen colocones distintos y que, médicamente, tienen diferentes efectos. Ciertos investigadores suponen que la diferencia entre las proporciones de los distintos cannabinoides de una variedad a otra o incluso entre distintos ejemplares de una misma variedad- es la causa de estas variaciones.

Al principio de los 90, los científicos descubrieron que los cannabinoides actúan de igual manera que cierto proceso químico que se produce naturalmente en el cerebro (sistema cannabinoide). (articulo muy interesante al respecto).

Así, los efectos de la marihuana están causados por mecanismos biológicos relacionados con esta química natural.

El cerebro y el sistema nervioso contienen muchos sistemas diferentes de mecanismos biológicos, llamados sistemas receptores. Los receptores son lugares que reaccionan a sustancias químicas específicas produciendo reacciones específicas. Estas sustancias son llamadas neurotransmisores, y la cascada de reacciones en cadena a través de las redes de estos sistemas es el proceso por el cual diferentes áreas cerebrales se comunican entre sí; de esta manera trabaja el cerebro.

La mayoría de las drogas producen sus efectos interfiriendo o activando los procesos de sistemas específicos.

Los barbitúricos, tienen un efecto no específico sobre los canales del ion cloruro; esto incrementa la actividad de un neurotransmisor llamado GABA; un incremento en la actividad del GABA tiene un efecto sedante. Las benzodiacepinas, como el Valium, tienen un efecto específico que aumenta la actividad del GABA en los receptores.

Antes del descubrimiento del sistema receptor de los cannabinoides a principios de los 90, algunos científicos especulaban con la posibilidad de que la marihuana produjera sus efectos a través de una acción no específica, igual que los barbitúricos. Los efectos no específicos suelen ser más extensos y peligrosos que los producidos por la activación de un receptor.

De hecho, los efectos de la marihuana son producidos por un sistema receptor de cannabinoides consistente en, al menos, dos tipos de receptores: el CB1 y el CB2, localizados en el cerebro u en el bazo, respectivamente.

Las acciones biológicas asociadas actualmente con los receptores de cannabinoides incluyen los efectos de la marihuana como analgésico, sobre la memoria y cognición, sobre la función locomotora, el sistema endocrino y otras funciones centrales como la termorregulación (disminución de la temperatura corporal), la actividad frenética (alteraciones del pulso, taquicardia), supresión de las nauseas y vómitos, y disminución de la presión intraocular.

Los científicos conocen hasta cierto punto como funcionan los receptores del CB1, pero se posee una comprensión limitada de cómo las neuronas receptivas a los cannabinoides interactuan con otros sistemas neurológicos. El CB2 fue descubierto con posterioridad, y el conocimiento acerca del mismo es aún escaso.

La tolerancia a la marihuana se desarrolla tras la ingestión continua de grandes cantidades de cannabinoides; en respuesta el cerebro disminuye el número de receptores a los cannabinoides disponible.

Cuando acaba dicha ingestión excesiva, los receptores aumentan hasta alcanzar el nivel natural. El neurotransmisor natural al cual responde el sistema receptor de cannabinoides recibe el nombre de anandamida (de la palabra sánscrita que designa a la felicidad/santidad).

En su forma natural, la anandamida tiene una potencia considerablemente inferior a la del THC, el cannabinoide primario de la marihuana.

A pesar de todo, la anandamida juega un importante papel en el cerebro, y los investigadores de NIDA (Instituto Nacional del Abuso de Drogas) creen que podrán demostrar que ayuda al cuerpo en su lucha contra el estrés, el dolor y las náuseas.

No se ha informado nunca de una sobredosis fatal en un ser humano. Esta seguridad refleja la escasez de receptores en el núcleo medular, la parte del sistema nervioso (bulbo raquídeo) que controla las funciones respiratoria y cardiovascular.

Concentrado Explosivo

Siguiendo la misma receta que para el concentrado cannabico, pero llevado al extremo podeis apreciar esta reducción a simple vista y el gozoso tono acaramelado del producto final: